PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C016260P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Nin-like
Protein Properties Length: 807aa    MW: 88859.6 Da    PI: 5.8381
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C016260P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.72.6e-29403454152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  MELO3C016260P1 403 AEKSISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 454
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.871393474IPR003035RWP-RK domain
PfamPF020422.9E-26407454IPR003035RWP-RK domain
SuperFamilySSF542771.64E-23705793No hitNo description
SMARTSM006661.2E-25711793IPR000270PB1 domain
PROSITE profilePS5174526.011711793IPR000270PB1 domain
PfamPF005645.8E-19712792IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2406.7E-26712792No hitNo description
CDDcd064075.43E-38712792No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 807 aa     Download sequence    Send to blast
MASLTFMFSL DADQDGYLGL PGRVFQQKLP EWTPNVQYYS SKEYPRLSHA LNYNVQGTLA  60
LPVFDPSGHS CLGVLELIMT SPKINYAPEV DKVCKALEAV NLKSSEILDH PNNQICNEGR  120
QNALAEILEV LTVVCETHNL PLAQTWVPCR HRNVLAYGGG LKKSCTSFDG SCMGRICMSA  180
TEVASYVVDA HMWGFRDACL EHHLQKGQGV SGRAFLSHSS CFCGDITQFC KTEYPLVHYA  240
LMFGLKSCFS ICLRSTFTGD DEYILEFFLP PSIVDYQEQK NLLGALMATM KKHFYTLKVA  300
SGINLEDKEG FVEIIQASRN GGFDSRLEYI QIPQPVELPP ASDAMPKAVE VAALETLQQQ  360
SLMVHDAPKD ENNGAWDGES HKPVPCPQNK EVKKTSERKR GKAEKSISLE VLQQYFAGSL  420
KDAAKSLGVC PTTMKRICRQ HGISRWPSRK INKVNRSLSK LKRVIESVQG AEGAFGISSL  480
ATSPLPVTVS SSSHPLTPEG SNQQNFVASQ PSDSQYKETN TSEAQTNDTQ ARLEDQLHRG  540
VLSPEEPIHE QNGFLPKFGN GLNNFRTGSG SREESAGTPT SHGSCQGSPA NDSALANNPI  600
SIPQHEQCVR RESPEVAFHP IDKLNVSAPA CSIPDTLVMV EPEEPFGGML IEDAGSSKDL  660
KNLCASVADA VLDEPVPEFC WSNHHDIALR QPMDSICHTV PHISLRQEPR RMTIKATYKE  720
DIIRFRIPLS SGIVELREEV AKRLKLEVGT FDIKYIDDDR EWVLIACDAD LQECVDISKS  780
SGSNIIRLSV HDLNVNLGSS CESTGE*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818730.0LN681873.1 Cucumis melo genomic scaffold, anchoredscaffold00027.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008451916.10.0PREDICTED: LOW QUALITY PROTEIN: protein NLP7-like
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLA0A0A0KX540.0A0A0A0KX54_CUCSA; Uncharacterized protein
STRINGVIT_02s0025g02070.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42573456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7